{"product_id":"proteintech-17618-1-ap","title":"Proteintech, 17618-1-AP, SBDS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SBDS (17618-1-AP) by Proteintech is a Polyclonal antibody targeting SBDS in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17618-1-AP targets SBDS in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HL-60 cells,  SH-SY5Y cells,  HEK-293T cells\nPositive IP detected in: HL-60 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nShwachman-Bodian-Diamond syndrome (SBDS) is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated \n\nwith Shwachman-Bodian-Diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined. This gene has a closely linked pseudogene that is distally located. This antibody is a rabbit polyclonal antibody raised against a full-length human SBDS protein, recognizes specifically the 29kd SBDS protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11814 Product name: Recombinant human SBDS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC065700 Sequence: MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE Predict reactive species\nFull Name: Shwachman-Bodian-Diamond syndrome\nCalculated Molecular Weight: 250 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC065700\nGene Symbol: SBDS\nGene ID (NCBI): 51119\nRRID: AB_2184481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3A5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869428863145,"sku":"17618-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17618-1-ap","provider":"Iright","version":"1.0","type":"link"}