{"product_id":"proteintech-17626-1-ap","title":"Proteintech, 17626-1-AP, IL-7Ra\/CD127 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-7Ra\/CD127 (17626-1-AP) by Proteintech is a Polyclonal antibody targeting IL-7Ra\/CD127 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n17626-1-AP targets IL-7Ra\/CD127 in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IF-P detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3600\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD127, also known as IL-7R subunit alpha (IL-7RA), is a type I membrane glycoprotein expressed on thymocytes, B cell precursors, most T cells, and some lymphoid and myeloid cells. IL-7R is a heterodimer composed of CD127 and the common-γ chain receptor (CD132). IL-7R plays critical roles in lymphocyte development and homeostasis. CD127 can also act as a receptor for thymic stromal lymphopoietin (TSLP).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11844 Product name: Recombinant human IL-7R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 266-459 aa of BC067537 Sequence: KRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSPSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ Predict reactive species\nFull Name: interleukin 7 receptor\nCalculated Molecular Weight: 459 aa, 52 kDa\nObserved Molecular Weight: 56-58 kDa\nGenBank Accession Number: BC067537\nGene Symbol: CD127\nGene ID (NCBI): 3575\nENSEMBL Gene ID: ENSG00000168685\nRRID: AB_2126105\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16871\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868983054505,"sku":"17626-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17626-1-ap","provider":"Iright","version":"1.0","type":"link"}