{"product_id":"proteintech-17721-1-ap","title":"Proteintech, 17721-1-AP, DHX9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DHX9 (17721-1-AP) by Proteintech is a Polyclonal antibody targeting DHX9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17721-1-AP targets DHX9 in WB, IHC, IF\/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  rat spleen tissue,  rat testis tissue,  Jurkat cells\nPositive IHC detected in: mouse brain tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNA helicases play important roles in transcription, RNA processing, translation, and RNA replication. DEAD box proteins are putative RNA helicases that have a characteristic Asp-Glu-Ala-Asp (DEAD) box as 1 of 8 highly conserved sequence motifs. DHX9 a member of the DEAH family of proteins, which possess a double-stranded RNA-binding domain (dsRBD) and a helicase domain [PMID:20569003]. It unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure of DHX9 may subsequently influence interactions with proteins or other nucleic acids. It is also a component of the CRD-mediated complex that promotes MYC mRNA stability. In addition, it is involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2[PMID: 19029303, 22190748].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12104 Product name: Recombinant human DHX9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC014246 Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP Predict reactive species\nFull Name: DEAH (Asp-Glu-Ala-His) box polypeptide 9\nCalculated Molecular Weight: 1270 aa, 141 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC014246\nGene Symbol: DHX9\nGene ID (NCBI): 1660\nRRID: AB_2092506\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08211\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868847132841,"sku":"17721-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17721-1-ap","provider":"Iright","version":"1.0","type":"link"}