{"product_id":"proteintech-17725-1-ap","title":"Proteintech, 17725-1-AP, ATP6V1F Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP6V1F (17725-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V1F in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n17725-1-AP targets ATP6V1F in WB, IHC, CoIP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells,  HeLa cells,  Jurkat cells,  mouse liver tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human testis tissue,  human brain tissue,  human kidney tissue,  human pancreas tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP6V1F(V-type proton ATPase subunit F) is also named as ATP6S14, VATF and belongs to the V-ATPase F subunit family. It generates an electrochemical proton gradient that is acid and positive inside synaptic vesicles. ATP6V1F plays a major role as energizers of animal plasma membranes, especially apical plasma membranes of epithelial cells. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 14 kDa and 16 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12121 Product name: Recombinant human ATP6V1F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC107854 Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR Predict reactive species\nFull Name: ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F\nCalculated Molecular Weight: 119 aa, 13 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC107854\nGene Symbol: ATP6V1F\nGene ID (NCBI): 9296\nRRID: AB_2062680\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16864\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868993245353,"sku":"17725-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17725-1-ap","provider":"Iright","version":"1.0","type":"link"}