{"product_id":"proteintech-17743-1-ap","title":"Proteintech, 17743-1-AP, YPEL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YPEL1 (17743-1-AP) by Proteintech is a Polyclonal antibody targeting YPEL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17743-1-AP targets YPEL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  human liver tissue,  human testis tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11993 Product name: Recombinant human YPEL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC074501 Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIDLAHMIKDNGWE Predict reactive species\nFull Name: yippee-like 1 (Drosophila)\nCalculated Molecular Weight: 119 aa, 14 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC074501\nGene Symbol: YPEL1\nGene ID (NCBI): 29799\nRRID: AB_2217464\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60688\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869793931433,"sku":"17743-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17743-1-ap","provider":"Iright","version":"1.0","type":"link"}