{"product_id":"proteintech-17798-1-ap","title":"Proteintech, 17798-1-AP, GORAB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GORAB (17798-1-AP) by Proteintech is a Polyclonal antibody targeting GORAB in WB, ELISA applications with reactivity to human, mouse samples\n17798-1-AP targets GORAB in WB, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse lung tissue,  HeLa cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGORAB, also known as Scyl1BP1, is a protein that localizes to the trans-side of the Golgi apparatus and plays a significant role in intracellular trafficking and protein glycosylation. It is composed of a central coiled-coil region that is responsible for Golgi targeting, likely through interactions with small GTPases Rab6 and Arf5. GORAB is considered a member of the golgin family of coiled-coil Golgi proteins, which are involved in vesicle tethering. GORAB has been implicated in several cellular functions. It has been proposed to function as a transcriptional activator for neurite outgrowth, as a modulator of MDM2 ubiquitylation impacting p53 levels and apoptosis, and has been shown to play a role in centriole duplication and ciliogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12002 Product name: Recombinant human GORAB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC064945 Sequence: MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYAR Predict reactive species\nFull Name: golgin, RAB6-interacting\nCalculated Molecular Weight: 264aa,28 kDa; 394aa,45 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC064945\nGene Symbol: GORAB\nGene ID (NCBI): 92344\nRRID: AB_10755145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T7V8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998652073,"sku":"17798-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17798-1-ap","provider":"Iright","version":"1.0","type":"link"}