{"product_id":"proteintech-17823-1-ap","title":"Proteintech, 17823-1-AP, LGALS13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LGALS13 (17823-1-AP) by Proteintech is a Polyclonal antibody targeting LGALS13 in WB, IHC, ELISA applications with reactivity to human samples\n17823-1-AP targets LGALS13 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGalectins are glycan-binding proteins that regulate innate and adaptive immune responses, and some confer maternal-fetal immune tolerance in eutherian mammals.  Three of the five human cluster galectins are solely expressed in the placenta, where they may confer additional immunoregulatory functions to enable deep placentation (PMID: 25191322). One of these is galactoside-binding soluble lectin 13 (LGALS13, also known as Galectin-13 and PP13), which has a high affinity for the sugar residues of glycoproteins. PP13 is implicated in placentation and is involved in inflammation and immune defense required for trophoblast invasion during uterine artery remodeling in early pregnancy (PMID: 19497882; 10527825; 21596368; 26018511).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12192 Product name: Recombinant human LGALS13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-139 aa of BC066304 Sequence: MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN Predict reactive species\nFull Name: lectin, galactoside-binding, soluble, 13\nCalculated Molecular Weight: 139 aa, 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC066304\nGene Symbol: LGALS13\nGene ID (NCBI): 29124\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHV8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887703085225,"sku":"17823-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17823-1-ap","provider":"Iright","version":"1.0","type":"link"}