{"product_id":"proteintech-17829-1-ap","title":"Proteintech, 17829-1-AP, SLC35E2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC35E2B (17829-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35E2B in WB, ELISA applications with reactivity to human, mouse samples\n17829-1-AP targets SLC35E2B in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC35E2B, also known as SLC35E2, encodes solute carrier family 35 member E2B, functioning as a putative transporter. SLC35E2B is expressed in the heart, retina, skin, testis, and kidney (PMID:33711669).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12211 Product name: Recombinant human RP11-345P4.4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-82 aa of BC092507 Sequence: MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGVWSSRALLYLTLW Predict reactive species\nFull Name: similar to solute carrier family 35, member E2\nCalculated Molecular Weight: 236 aa, 43 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC092507\nGene Symbol: SLC35E2B\nGene ID (NCBI): 728661\nRRID: AB_3085542\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P0CK96\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806206121,"sku":"17829-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17829-1-ap","provider":"Iright","version":"1.0","type":"link"}