{"product_id":"proteintech-17847-1-ap","title":"Proteintech, 17847-1-AP, BDKRB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BDKRB2 (17847-1-AP) by Proteintech is a Polyclonal antibody targeting BDKRB2 in WB, ELISA applications with reactivity to human samples\n17847-1-AP targets BDKRB2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe BK system is important in cancer occurrence and progression. It stimulates cell proliferation, migration, and angiogenesis, contributing to tumor progression. As a vital receptor of bradykinin, BDKRB2 (Bradykinin receptor B2) has been widely reported in a range of malignancies, including cervical cancer, triple-negative breast cancer, hepatocellular carcinoma (HCC), gastric cancer, colorectal cancer, prostate cancer, bladder cancer, head and neck squamous cell carcinomas, and chondrosarcoma (PMID: 33686021).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12268 Product name: Recombinant human BDKRB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-391 aa of BC074895 Sequence: FLDTLHRLGILSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ Predict reactive species\nFull Name: bradykinin receptor B2\nCalculated Molecular Weight: 391 aa, 44 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC074895\nGene Symbol: BDKRB2\nGene ID (NCBI): 624\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30411\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885213077673,"sku":"17847-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17847-1-ap","provider":"Iright","version":"1.0","type":"link"}