{"product_id":"proteintech-17852-1-ap","title":"Proteintech, 17852-1-AP, TNFSF8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNFSF8 (17852-1-AP) by Proteintech is a Polyclonal antibody targeting TNFSF8 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n17852-1-AP targets TNFSF8 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNFSF8, also named as CD30LG and CD153, is a member of the tumor necrosis factor (TNF) receptor superfamily, is a surface antigen used as a clinical marker for Hodgkin lymphoma and related hematologic malignancies. It induces proliferation of T-cells. CD30L enhanced the proliferation of CD3-activated T cells, but induced differential responses, including cell death, in several CD30-positive lymphoma-derived cell lines. For Glycosylation, the MW in WB detection is about 35-40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12303 Product name: Recombinant human TNFSF8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-234 aa of BC093630 Sequence: VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 8\nCalculated Molecular Weight: 234 aa, 26 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC093630\nGene Symbol: TNFSF8\nGene ID (NCBI): 944\nRRID: AB_2878452\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32971\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887834583209,"sku":"17852-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17852-1-ap","provider":"Iright","version":"1.0","type":"link"}