{"product_id":"proteintech-17871-1-ap","title":"Proteintech, 17871-1-AP, ACOT12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACOT12 (17871-1-AP) by Proteintech is a Polyclonal antibody targeting ACOT12 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n17871-1-AP targets ACOT12 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HuH-7 cells,  rat liver tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACOT12 is an acyl-coenzyme A thioesterase that hydrolyzes acyl-coenzyme A (acyl-CoA) to free fatty acids and coenzyme A, thereby regulating intracellular levels of acyl-CoA and free fatty acids. It plays a key role in lipid metabolism and is mainly expressed in the kidney, liver, and intestine. ACOT12 plays an important role in a variety of diseases, including renal fibrosis, nonalcoholic fatty liver disease (NAFLD), and hepatocellular carcinoma. In renal fibrosis, downregulation of ACOT12 expression leads to lipid accumulation and exacerbates the fibrotic process. Restoration of its expression ameliorates renal fibrosis, suggesting that ACOT12 is a potential therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12355 Product name: Recombinant human ACOT12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 206-555 aa of BC075011 Sequence: MAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITFPRIQPISKDDFRRYRGAIARKRIRLGRKYVISHKEEVPLCIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHFVSCEVIDWVSEDDQLYHITCPILNDDKPKDLVVLVSRRKPLKDGNTYTVAVKSVILPSVPPSPQYIRSEIICAGFLIHAIDSNSCIVSYFNHMSASILPYFAGNLGGWSKSIEETAASCIQFLENPPDDGFVSTF Predict reactive species\nFull Name: acyl-CoA thioesterase 12\nCalculated Molecular Weight: 555 aa, 62 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC075011\nGene Symbol: ACOT12\nGene ID (NCBI): 134526\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WYK0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869630615721,"sku":"17871-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17871-1-ap","provider":"Iright","version":"1.0","type":"link"}