{"product_id":"proteintech-17879-1-ap","title":"Proteintech, 17879-1-AP, NDUFA11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFA11 (17879-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA11 in WB, ELISA applications with reactivity to human samples\n17879-1-AP targets NDUFA11 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MDA-MB-231 cells,  RT-4 cells,  U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial complex I is assembled from 44 subunits into an L-shaped complex, with a hydrophobic arm embedded in the inner mitochondrial membrane and the other arm protruding into the mitochondrial matrix. NDUFA11 encodes a subunit of the membrane-bound mitochondrial complex I, and functions in assembly, stability, and regulation of the complex. Mutations in NDUFA11 are associated with severe mitochondrial complex I deficiency(PMID: 18306244).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11746 Product name: Recombinant human NDUFA11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-111 aa of BC069045 Sequence: MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIG Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa\nCalculated Molecular Weight: 141 aa, 15 kDa\nObserved Molecular Weight: 10-15 kDa\nGenBank Accession Number: BC069045\nGene Symbol: NDUFA11\nGene ID (NCBI): 126328\nRRID: AB_3669282\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86Y39\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869716795561,"sku":"17879-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17879-1-ap","provider":"Iright","version":"1.0","type":"link"}