{"product_id":"proteintech-17895-1-ap","title":"Proteintech, 17895-1-AP, BHLHE40 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BHLHE40 (17895-1-AP) by Proteintech is a Polyclonal antibody targeting BHLHE40 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17895-1-AP targets BHLHE40 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, HeLa cells,  MDA-MB-231 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human endometrial cancer tissue, human pancreas cancer tissue,  mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBHLHE40 (Basic Helix-Loop-Helix Family Member E40), also known as BHLHB2, STRA13, DEC1, or SHARP2, is a member of the basic helix-loop-helix (bHLH) protein family, a large superfamily of transcriptional regulators expressed in many organisms. BHLHE40 is known to regulate a wide variety of essential cellular processes, including cell cycle, cellular proliferation, programmed cell death, cellular development and differentiation, as well as circadian rhythms (PMID: 34551158). It is reported that BHLHE40 is overexpressed in gastric, breast, and brain tumors; and downregulated in colorectal, esophageal, pancreatic and lung cancer (PMID: 32577154).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12236 Product name: Recombinant human BHLHE40 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-412 aa of BC082238 Sequence: MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD Predict reactive species\nFull Name: basic helix-loop-helix family, member e40\nCalculated Molecular Weight: 412 aa, 46 kDa\nObserved Molecular Weight: 46-50 kDa\nGenBank Accession Number: BC082238\nGene Symbol: BHLHE40\nGene ID (NCBI): 8553\nRRID: AB_2065351\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14503\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868896088233,"sku":"17895-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17895-1-ap","provider":"Iright","version":"1.0","type":"link"}