{"product_id":"proteintech-17908-1-ap","title":"Proteintech, 17908-1-AP, EPO\/Erythropoietin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPO\/Erythropoietin (17908-1-AP) by Proteintech is a Polyclonal antibody targeting EPO\/Erythropoietin in WB, IHC, ELISA applications with reactivity to human, rat samples\n17908-1-AP targets EPO\/Erythropoietin in WB, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nErythropoietin (Epo) is a member of the EPO\/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. Erythropoietin (Epo) is a 166 amino acids protein containing three N-glycosylation sites (Asn-24, Asn-38, and Asn-83) and 1 O- glycosylation site (Ser-126) and involved in the regulation of the level of red blood cells. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. Its effect is realized by binding erythropoietin receptor (EpoR) expressed on erythroid progenitor cells. EpoR, is a glycoprotein expressed on megakaryocytes, erythroid progenitors and endothelial cells. Epo also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, rat, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12302 Product name: Recombinant human EPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-193 aa of BC093628 Sequence: VHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Predict reactive species\nFull Name: erythropoietin\nCalculated Molecular Weight: 193 aa, 21 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC093628\nGene Symbol: EPO\/Erythropoietin\nGene ID (NCBI): 2056\nRRID: AB_10638147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01588\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868997406889,"sku":"17908-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17908-1-ap","provider":"Iright","version":"1.0","type":"link"}