{"product_id":"proteintech-17934-1-ap","title":"Proteintech, 17934-1-AP, DRD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DRD1 (17934-1-AP) by Proteintech is a Polyclonal antibody targeting DRD1 in WB, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n17934-1-AP targets DRD1 in WB, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IF-Fro detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDopamine is a neurotransmitter that plays a crucial role in physical and mental health, such as cardiovascular, hormonal, renal, and central nervous systems (PMID: 29220802). Five subtypes of mammalian dopamine receptors are grouped into two classes, the D1- and D2-like classes. The D1-like class includes D1 and D5 receptors whereas the D2-like class includes D2, D3, D4 subtypes (PMID: 9457173). Dopamine receptor D1 (DRD1) is the most abundant form of dopamine receptor in the central nervous system. DRD1 stimulates adenylate cyclase, modulates D2 receptor activity, regulates neuron growth and differentiation, and mediates several behavioral responses (PMID: 1977312). DRD1 has a calculated molecular weight of 49 kDa, larger apparent molecular weight of 60-80 kDa may be due to glycosylation (PMID: 1281547; 23821371).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12366 Product name: Recombinant human DRD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 338-446 aa of BC074978 Sequence: RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT Predict reactive species\nFull Name: dopamine receptor D1\nCalculated Molecular Weight: 446 aa, 49 kDa\nObserved Molecular Weight: 50-75 kDa\nGenBank Accession Number: BC074978\nGene Symbol: DRD1\nGene ID (NCBI): 1812\nRRID: AB_10598308\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21728\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868864434345,"sku":"17934-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17934-1-ap","provider":"Iright","version":"1.0","type":"link"}