{"product_id":"proteintech-17935-1-ap","title":"Proteintech, 17935-1-AP, CNOT6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNOT6 (17935-1-AP) by Proteintech is a Polyclonal antibody targeting CNOT6 in WB, ELISA applications with reactivity to human samples\n17935-1-AP targets CNOT6 in WB, RIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe evolutionarily conserved CCR4-NOT (CNOT) complex regulates mRNA metabolism in eukaryotic cells. This regulation occurs at different levels of mRNA synthesis and degradation, including transcription initiation, elongation, deadenylation, and degradation (PMID: 12882519). Multiple components, including CNOT1, CNOT2, CNOT3, CNOT4, CNOT6, CNOT6L, CNOT7, CNOT8, CNOT9, and CNOT10 have been identified in this complex (PMID: 19558367). In addition, the subunit composition of this complex has been shown to vary among different tissues (PMID: 21741365). The various CNOT proteins display different functions, with CNOT6, CNOT6L, CNOT7, and CNOT8 exhibiting 3'-5' RNAse activity (PMID: 11889047). Research studies indicate that the CCR4-NOT deadenylase subunits CNOT6 and CNOT6L help mediate cell survival and play a role in cell proliferation, P-body formation, and regulation of gene expression (PMID: 21233283). Additional research evidence suggests that CNOT6 can act as a nuclear hormone receptor coactivator that associates with ZNF335 (NIF-1) to regulate expression from specific RARα regulated genes (PMID: 18180299).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11506 Product name: Recombinant human CNOT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC027476 Sequence: MCIMTISSEGELELVGLMRLRKQLFLRSALCNHRSRELYGSGRGGALTHVVFVNGGCHLFIDAGTRVHLLDAKGLSFTQNVFICICYCLQYI Predict reactive species\nFull Name: CCR4-NOT transcription complex, subunit 6\nCalculated Molecular Weight: 557 aa, 63.3 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC027476\nGene Symbol: CNOT6\nGene ID (NCBI): 57472\nRRID: AB_2935444\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULM6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869525823657,"sku":"17935-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17935-1-ap","provider":"Iright","version":"1.0","type":"link"}