{"product_id":"proteintech-17942-1-ap","title":"Proteintech, 17942-1-AP, Neurokinin-1 receptor Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Neurokinin-1 receptor (17942-1-AP) by Proteintech is a Polyclonal antibody targeting Neurokinin-1 receptor in WB, ELISA applications with reactivity to human, mouse, rat samples\n17942-1-AP targets Neurokinin-1 receptor in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, THP-1 cells,  mouse pancreas tissue,  Caco-2 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nneurokinin 1 receptor (NK1R, also known as the tachykinin 1 receptor, TACR1), a mediator of behavioral stress responses, in alcohol dependence and treatment. One such neurotransmitter is substance P (SP), which together with its preferred TACR1 is highly expressed in brain areas involved in stress responses and drug reward, including the hypothalamus, amygdala, and nucleus accumbens (PMID: 18276852).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12368 Product name: Recombinant human TACR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 304-407 aa of BC074911 Sequence: IYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS Predict reactive species\nFull Name: tachykinin receptor 1\nCalculated Molecular Weight: 407 aa, 46 kDa\nObserved Molecular Weight: 45-55 kDa\nGenBank Accession Number: BC074911\nGene Symbol: Neurokinin-1 receptor\nGene ID (NCBI): 6869\nRRID: AB_2200611\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25103\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970864809,"sku":"17942-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17942-1-ap","provider":"Iright","version":"1.0","type":"link"}