{"product_id":"proteintech-17968-1-ap","title":"Proteintech, 17968-1-AP, uPA\/Urokinase Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe uPA\/Urokinase (17968-1-AP) by Proteintech is a Polyclonal antibody targeting uPA\/Urokinase in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17968-1-AP targets uPA\/Urokinase in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, human brain tissue,  A375 cells,  Hela cells,  LNCaP cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissue, human bowen disease,  human lung tissue,  human ovary tissue,  human prostate cancer tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLAU(Urokinase-type plasminogen activator) is also named as uPA and belongs to the peptidase S1 family.UPA initiates a proteolytic cascade, which degrades extracellular matrix during tissue growth and remodelling.The secreted proform of UPA is activated after binding to a specific high affinity cell surface receptor. Secreted UPA is exposed to rapid inactivation in the pericellular space by plasminogen activator inhibitor-1 (PAI-1), which is stored in the extracellular matrix bound to vitronectin(PMID:9665342).It has 2 isoforms produced by alternative splicing. Defects in PLAU are the cause of Quebec platelet disorder (QPD).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11813 Product name: Recombinant human uPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-431 aa of BC013575 Sequence: ASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL Predict reactive species\nFull Name: plasminogen activator, urokinase\nCalculated Molecular Weight: 431 aa, 49 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC013575\nGene Symbol: Urokinase\nGene ID (NCBI): 5328\nRRID: AB_2165202\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00749\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868840939689,"sku":"17968-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17968-1-ap","provider":"Iright","version":"1.0","type":"link"}