{"product_id":"proteintech-18013-1-ap","title":"Proteintech, 18013-1-AP, IFN Alpha Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFN Alpha (18013-1-AP) by Proteintech is a Polyclonal antibody targeting IFN Alpha in WB, ELISA applications with reactivity to human samples\n18013-1-AP targets IFN Alpha in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFNA1 (IFN-alpha) is a member of the Type I IFN (1) family best known for their antiviral activity. It is a key cytokine regulating the activity of B cells, T-helper cells (Th cells), cDCs and natural killer cells (NK cells). IFN-alpha induces B cell maturation into plasma cells and immunoglobulin production. IFN-alpha plays an important role in the pathogenesis of systemic lupus erythematosus (SLE). IFN-alpha was the first cytokine to show clinical benefit in the treatment of certain types of cancer, including melanoma, chronic myelogenous leukemia, and renal cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12533 Product name: Recombinant human IFNA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-189 aa of BC074928 Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE Predict reactive species\nFull Name: IFNA1\nCalculated Molecular Weight: 189 aa, 22 kDa\nGenBank Accession Number: BC074928\nGene Symbol: IFN alpha1\nGene ID (NCBI): 3439\nRRID: AB_2878481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01562\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893794473,"sku":"18013-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18013-1-ap","provider":"Iright","version":"1.0","type":"link"}