{"product_id":"proteintech-18034-1-ap","title":"Proteintech, 18034-1-AP, GIP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GIP (18034-1-AP) by Proteintech is a Polyclonal antibody targeting GIP in IHC, ELISA applications with reactivity to human, rat, mouse samples\n18034-1-AP targets GIP in IHC, ELISA applications and shows reactivity with human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human pancreas tissue, rat pancreas tissue,  mouse pancreas tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGIP is an incretin hormone and belongs to the glucagon superfamily. GIP is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption.GIP stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12634 Product name: Recombinant human GIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-153 aa of BC069663 Sequence: EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR Predict reactive species\nFull Name: gastric inhibitory polypeptide\nCalculated Molecular Weight: 153 aa, 17 kDa\nGenBank Accession Number: BC069663\nGene Symbol: GIP\nGene ID (NCBI): 2695\nRRID: AB_2878484\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09681\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887651213481,"sku":"18034-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18034-1-ap","provider":"Iright","version":"1.0","type":"link"}