{"product_id":"proteintech-18036-1-ap","title":"Proteintech, 18036-1-AP, SAP102 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SAP102 (18036-1-AP) by Proteintech is a Polyclonal antibody targeting SAP102 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18036-1-AP targets SAP102 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynapse-associated protein 102 (SAP102), also known as DLG3, is a MAGUK that is highly expressed early in development and mediates receptor trafficking during synaptogenesis. The importance of SAP102 function in brain development is demonstrated by the fact that SAP102 mutations have been identified in human patients with nonsyndromic X-linked mental retardation (XLMR).SAP102 has critical roles in early cortical synapse development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12658 Product name: Recombinant human DLG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 466-817 aa of BC093864 Sequence: RPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL Predict reactive species\nFull Name: discs, large homolog 3 (Drosophila)\nCalculated Molecular Weight: 817 aa, 90 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC093864\nGene Symbol: SAP102\nGene ID (NCBI): 1741\nRRID: AB_2092175\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92796\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869591654569,"sku":"18036-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18036-1-ap","provider":"Iright","version":"1.0","type":"link"}