{"product_id":"proteintech-18041-1-ap","title":"Proteintech, 18041-1-AP, Oxytocin-neurophysin 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Oxytocin-neurophysin 1 (18041-1-AP) by Proteintech is a Polyclonal antibody targeting Oxytocin-neurophysin 1 in IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18041-1-AP targets Oxytocin-neurophysin 1 in IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse pituitary gland tissue\nPositive IHC detected in: human pituitary tissue, mouse ovary tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOxytocin-neurophysin 1, also called the oxytocin\/neurophysin I prepropeptide, is produced in the hypothalamus as a single, inactive precursor that contains two parts: the nonapeptide hormone oxytocin and its carrier protein neurophysin I. After synthesis in magnocellular neurons of the supra-optic and paraventricular nuclei, the precursor is packaged into neurosecretory vesicles and transported down the axon to the posterior pituitary (neurohypophysis). During this axonal transport the precursor is proteolytically cleaved, generating mature oxytocin and its tightly bound neurophysin I; the complex is stored in nerve terminals and secreted into the systemic circulation upon appropriate stimulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12672 Product name: Recombinant human OXT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-125 aa of BC101841 Sequence: ACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR Predict reactive species\nFull Name: oxytocin, prepropeptide\nCalculated Molecular Weight: 125 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC101841\nGene Symbol: OXT\nGene ID (NCBI): 5020\nRRID: AB_2918056\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01178\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869723152553,"sku":"18041-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18041-1-ap","provider":"Iright","version":"1.0","type":"link"}