{"product_id":"proteintech-18075-1-ap","title":"Proteintech, 18075-1-AP, PCDHA9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCDHA9 (18075-1-AP) by Proteintech is a Polyclonal antibody targeting PCDHA9 in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n18075-1-AP targets PCDHA9 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtocadherins, which constitute the largest subgroup within the cadherin superfamily, are predominantly expressed in the nervous system and are probably involved in the regulation of neuronal recognition and connectivity (PMID: 17936607; 12231349; 17133224). The protocadherin subfamily can be further subdivided into three groups: the clustered protocadherins, comprising α-, β- and γ-protocadherins; δ-protocadherins;  and others, many of which are solitary (PMID: 17133224). PCDHA9 belongs to the α-protocadherin (PCDHA) cluster. A homozygous variant in PCDHA9 has been found in three unrelated Chinese ALS patients, suggesting PCDHA9 as a candidate gene for amyotrophic lateral sclerosis(PMID: 38467605).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12767 Product name: Recombinant human PCDHA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-401 aa of BC104802 Sequence: QLHYSVPEEAEHGTFVGRIAQDLGLELAELVPRLFQLDSKGRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVDVEVKDINDNPPVFPATQKNLFIAESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLLTATDGGKPELTGTVQLLITVLDNNDNAPVFDRTLYTVKLPENVSIGTLVIHPNASDLDEGLNGDIIYSFSSDVSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTLLVEVVDVNDNAPQLTIKTLSVPVKEDAQLGTVIALISVIDLDADANGQVTCSLTPHVPFKLVSTY Predict reactive species\nFull Name: protocadherin alpha 9\nCalculated Molecular Weight: 950 aa, 102 kDa\nObserved Molecular Weight: 91 kDa\nGenBank Accession Number: BC104802\nGene Symbol: PCDHA9\nGene ID (NCBI): 9752\nRRID: AB_2878491\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5H5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869570486441,"sku":"18075-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18075-1-ap","provider":"Iright","version":"1.0","type":"link"}