{"product_id":"proteintech-18099-1-ap","title":"Proteintech, 18099-1-AP, TRAF3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAF3 (18099-1-AP) by Proteintech is a Polyclonal antibody targeting TRAF3 in WB, IP, ELISA applications with reactivity to human, mouse samples\n18099-1-AP targets TRAF3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, multi-cells,  HEK-293 cells,  HeLa cells,  NIH\/3T3 cells,  Raji cells,  Jurkat cells\nPositive IP detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNF receptor-associated factor 3 (TRAF3) has many alternative names including CAP-1, CD40 receptor-associated factor 1(CRAF1), CD40-binding protein(CD40BP) and LMP1-associated protein 1 (LAP1). TRAF3 regulates pathways leading to the activation of NF-kappa-B and MAP kinases, and plays a central role in the regulation of innate immune response. It modulates signaling pathways leading to the production of cytokines and interferon. As an essential constituent of several E3 ubiquitin-protein ligase complexes, TRAF3 promote 'Lys-63'-linked ubiquitination of target proteins. Moreover, TRAF3 undergoes both 'Lys-48'-linked and 'Lys-63'-linked ubiquitination in response to various stimuli and is deubiquitinated by OTUB1, OTUB2 and OTUD5. Several alternatively spliced transcript variants encoding distinct isoforms (64 kDa and 55 kDa) have been reported.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12185 Product name: Recombinant human TRAF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-351 aa of BC075087 Sequence: KMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMK Predict reactive species\nFull Name: TNF receptor-associated factor 3\nCalculated Molecular Weight: 568 aa, 64 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC075087\nGene Symbol: TRAF3\nGene ID (NCBI): 7187\nRRID: AB_10837364\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13114\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868862238889,"sku":"18099-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18099-1-ap","provider":"Iright","version":"1.0","type":"link"}