{"product_id":"proteintech-18118-1-ap","title":"Proteintech, 18118-1-AP, GCNT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GCNT2 (18118-1-AP) by Proteintech is a Polyclonal antibody targeting GCNT2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18118-1-AP targets GCNT2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue,  HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human liver tissue, human colon tissue,  human breast cancer tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGCNT2 (N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase) catalyzes the transfer of N-acetylglucosamine to the carbon-6 position of galactose. The loss of GCNT2 expression and corresponding loss of I-antigen in melanoma cells has profound effects on key oncogenic signaling pathways, including integrin-mediated signaling pathways critical for metastasis (PMID: 33660254, 30135430).  Alterations in GCNT2 expression have now been associated with multiple malignancies, with high GCNT2 promoting tumor progression in a majority of investigated cancers. Three GCNT2 splicing variants GCNT2A, -B, and -C, which differ at exon 1 but have identical exon 2 and 3 coding regions, are expressed differentially in specific tissues (PMID: 15161861). GCNT2C determines the expression of the blood group I antigen in erythrocytes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12635 Product name: Recombinant human GCNT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-400 aa of BC074801 Sequence: GDPSFQRLNISDPLRLTQVCTSFINGKTRFLWKNKLMIHEKSSCKEYLTQSHYITAPLSKEEADFPLAYIMVIHHHFDTFARLFRAIYMPQNIYCVHVDEKATTEFKDAVEQLLSCFPNAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF Predict reactive species\nFull Name: glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)\nCalculated Molecular Weight: 400 aa, 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC074801\nGene Symbol: GCNT2\nGene ID (NCBI): 2651\nRRID: AB_2232115\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N0V5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869544272041,"sku":"18118-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18118-1-ap","provider":"Iright","version":"1.0","type":"link"}