{"product_id":"proteintech-18137-1-ap","title":"Proteintech, 18137-1-AP, Importin Alpha 5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Importin Alpha 5 (18137-1-AP) by Proteintech is a Polyclonal antibody targeting Importin Alpha 5 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18137-1-AP targets Importin Alpha 5 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human testis tissue, human kidney tissue, human placenta tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nImportins (alpha and beta) are transport factors that transport proteins into the nucleus. alpha importins function by binding transcription factors at nuclear localization sequences (NLS), and associating with importin beta subunits to translocate through the nuclear pore. Six isoforms of alpha importins have been described in human. Importin alpha 5 is the predominant importin in adult CNS and is essential for differentiation and viability of neural cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12751 Product name: Recombinant human KPNA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 19-272 aa of BC002374 Sequence: LNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLA Predict reactive species\nFull Name: karyopherin alpha 1 (importin alpha 5)\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC002374\nGene Symbol: Importin Alpha 5\nGene ID (NCBI): 3836\nRRID: AB_2133553\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52294\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868861681833,"sku":"18137-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18137-1-ap","provider":"Iright","version":"1.0","type":"link"}