{"product_id":"proteintech-18173-1-ap","title":"Proteintech, 18173-1-AP, CLEC4G Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLEC4G (18173-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC4G in IHC, IF-P, ELISA applications with reactivity to human samples\n18173-1-AP targets CLEC4G in IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLEC4G, also known as LSECtin, is a member of the C-type lectin family of glycan-binding receptors that is expressed on sinusoidal endothelial cells in liver and lymph nodes. CLEC4G is a type II transmembrane protein of ∼40 kDa in size with a single C-type lectin-like domain at the COOH terminus, closest in homology to DC-SIGNR, DC-SIGN, and CD23. CLEC4G has been reported as a receptor for Japanese encephalitis virus (PubMed:24623090), ebolavirus (PubMed:16051304), SARS coronavirus\/SARS-CoV (PubMed:16051304), lassa virus and Lymphocytic choriomeningitis virus glycoprotein (PubMed:22156524, PubMed:22673088).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12837 Product name: Recombinant human CLEC4G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-293 aa of BC093691 Sequence: GHDLLRTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQESALRELRERVTQGLAEAGRGREDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFSVPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKRHNC Predict reactive species\nFull Name: C-type lectin domain family 4, member G\nCalculated Molecular Weight: 293 aa, 33 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC093691\nGene Symbol: CLEC4G\nGene ID (NCBI): 339390\nRRID: AB_2878512\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXB4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869656600745,"sku":"18173-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18173-1-ap","provider":"Iright","version":"1.0","type":"link"}