{"product_id":"proteintech-18177-1-ap","title":"Proteintech, 18177-1-AP, HEPACAM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HEPACAM (18177-1-AP) by Proteintech is a Polyclonal antibody targeting HEPACAM in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18177-1-AP targets HEPACAM in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse liver tissue,  rat brain tissue,  SK-N-SH cells\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human liver tissue, mouse brain tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHepaCAM (hepatocyte cell adhesion molecule), also known as GlialCAM, is a single-pass type I membrane glycoprotein of 416 amino acids. It displays a typical structure of immunoglobulin (Ig)-like adhesion molecules including two extracellular Ig-like domains, a transmembrane segment, and a cytoplasmic tail. It has been shown that hepaCAM forms a cis-homodimer on the cell surface, and modulates cell-matrix interaction. It is predominantly expressed in the CNS glial cells. Defects in HEPACAM gene are the cause of megalencephalic leukoencephalopathy with subcortical cysts type 2A (MLC2A). HEPACAM has also been suggested as a tumor suppressor gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12870 Product name: Recombinant human HEPACAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-242 aa of BC104831 Sequence: ITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCVVENPISQGRSLPVKITVYRRSSLY Predict reactive species\nFull Name: hepatocyte cell adhesion molecule\nCalculated Molecular Weight: 416 aa, 46 kDa\nObserved Molecular Weight: 46-72 kDa\nGenBank Accession Number: BC104831\nGene Symbol: HEPACAM\nGene ID (NCBI): 220296\nRRID: AB_2279680\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14CZ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868871479465,"sku":"18177-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18177-1-ap","provider":"Iright","version":"1.0","type":"link"}