{"product_id":"proteintech-18201-1-ap","title":"Proteintech, 18201-1-AP, Histone H1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Histone H1 (18201-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18201-1-AP targets Histone H1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue, mouse kidney tissue,  mouse lung tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistone H1 is a key chromatin structural protein, which mediates higher-order chromatin folding. H1 is also emerging as an important epigenetic mark and regulator of gene expression and cellular differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12704 Product name: Recombinant human Histone H1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC101593 Sequence: MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK Predict reactive species\nFull Name: histone cluster 1, H1a\nCalculated Molecular Weight: 215 aa, 22 kDa\nObserved Molecular Weight: 28 kDa, 30 kDa\nGenBank Accession Number: BC101593\nGene Symbol: Histone H1\nGene ID (NCBI): 3024\nRRID: AB_10859820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02539\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868999405737,"sku":"18201-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18201-1-ap","provider":"Iright","version":"1.0","type":"link"}