{"product_id":"proteintech-18219-1-ap","title":"Proteintech, 18219-1-AP, UBE2S Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE2S (18219-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2S in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18219-1-AP targets UBE2S in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells,  COLO 320 cells,  MCF-7 cells,  MDA-MB-453s cells,  mouse ovary tissue\nPositive IHC detected in: human skin cancer tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBE2S(Ubiquitin-conjugating enzyme E2 S) is also named as E2EPF and belongs to the ubiquitin-conjugating enzyme family. It acts as an essential factor of the anaphase promoting complex\/cyclosome (APC\/C) and a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Overexpression of UBE2S can increase tumor cell proliferation, invasion, and metastasis through the VHL-HIF pathway (PMID:16819549).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12978 Product name: Recombinant human UBE2S protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC004236 Sequence: MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2S\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC004236\nGene Symbol: UBE2S\nGene ID (NCBI): 27338\nRRID: AB_10598771\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16763\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887913455785,"sku":"18219-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18219-1-ap","provider":"Iright","version":"1.0","type":"link"}