{"product_id":"proteintech-18237-1-ap","title":"Proteintech, 18237-1-AP, MMP28 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMP28 (18237-1-AP) by Proteintech is a Polyclonal antibody targeting MMP28 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n18237-1-AP targets MMP28 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells,  human colon tissue,  mouse heart tissue\nPositive IHC detected in: human kidney tissue,  human ovary tissue,  human skin cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMP28(Epilysin)can degrade casein and play a role in tissues homeostasis and repair .The only specific human cell type recognized to express epilysin is the basal keratinocyte in the skin, where epilysin expression is upregulated during wound repair(PMID:16940349).Western blot showed this antibody recognize bands at 62 and 58 kDa as well as breakdown products at 50, 48, and 46 kDa(PMID:15953044).This antibody is specific to MMP28.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12980 Product name: Recombinant human MMP28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-393 aa of BC002631 Sequence: LGNAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKLFTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKVQSV Predict reactive species\nFull Name: matrix metallopeptidase 28\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC002631\nGene Symbol: MMP28\nGene ID (NCBI): 79148\nRRID: AB_2146444\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H239\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868925841577,"sku":"18237-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18237-1-ap","provider":"Iright","version":"1.0","type":"link"}