{"product_id":"proteintech-18260-1-ap","title":"Proteintech, 18260-1-AP, LILRB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LILRB3 (18260-1-AP) by Proteintech is a Polyclonal antibody targeting LILRB3 in WB, ELISA applications with reactivity to human samples\n18260-1-AP targets LILRB3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood leukocyte\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe leukocyte immunoglobulin-like receptors (LIRs, also known as ILTs, CD85, and LILRs) comprise a family of related immunoregulatory receptors encoded within the leukocyte receptor cluster (LRC) at chromosomal region 19q13.4 (PMID: 11491530). LIRs are transmembrane proteins containing either two or four extracellular immunoglobulin domains, and have diverse functions, including the regulation of inflammation, immune tolerance, cell differentiation and nervous system plasticity (PMID: 16406677; 26040207). LILRB3, also known as ILT-5 or CD85a, belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). LILRB3 is found on the surface of a variety of cell types including monocytes\/macrophages, granulocytes, NK cells and some T cells. It binds to MHC class I molecules and transduces a negative signal that inhibits stimulation of an immune response. LILRB3 has been reported as a myeloid cell checkpoint that elicits profound immunomodulation (PMID: 32870822).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13110 Product name: Recombinant human LILRB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-401 aa of BC112198 Sequence: RTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYRLDKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVNPSHRWRFTCYYYYMNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYS Predict reactive species\nFull Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3\nCalculated Molecular Weight: 631 aa, 69 kDa\nObserved Molecular Weight: 80-90 kDa\nGenBank Accession Number: BC112198\nGene Symbol: LILRB3\nGene ID (NCBI): 11025\nRRID: AB_2918060\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75022\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869555019945,"sku":"18260-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18260-1-ap","provider":"Iright","version":"1.0","type":"link"}