{"product_id":"proteintech-18268-1-ap","title":"Proteintech, 18268-1-AP, DEFA5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DEFA5 (18268-1-AP) by Proteintech is a Polyclonal antibody targeting DEFA5 in IHC, ELISA applications with reactivity to human samples\n18268-1-AP targets DEFA5 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEFA5, also named as DEF5, belongs to the alpha-defensin family. It has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. Mature DEFA5 is about 5kd. It has a homodimer form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12793 Product name: Recombinant human DEFA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-94 aa of BC069690 Sequence: ERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR Predict reactive species\nFull Name: defensin, alpha 5, Paneth cell-specific\nCalculated Molecular Weight: 94 aa, 10 kDa\nGenBank Accession Number: BC069690\nGene Symbol: DEFA5\nGene ID (NCBI): 1670\nRRID: AB_2878526\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01523\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887141212329,"sku":"18268-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18268-1-ap","provider":"Iright","version":"1.0","type":"link"}