{"product_id":"proteintech-18273-1-ap","title":"Proteintech, 18273-1-AP, P2RY1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe P2RY1 (18273-1-AP) by Proteintech is a Polyclonal antibody targeting P2RY1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18273-1-AP targets P2RY1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  mouse heart tissue\nPositive IHC detected in: human testis tissue,  human kidney tissue,  human lung tissue,  human ovary tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12992 Product name: Recombinant human P2RY1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species\nFull Name: purinergic receptor P2Y, G-protein coupled, 1\nCalculated Molecular Weight: 373 aa, 42 kDa\nObserved Molecular Weight: 42 kDa, 57 kDa-59 kDa, 66 kDa\nGenBank Accession Number: BC074785\nGene Symbol: P2RY1\nGene ID (NCBI): 5028\nRRID: AB_2158402\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47900\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887748534441,"sku":"18273-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18273-1-ap","provider":"Iright","version":"1.0","type":"link"}