{"product_id":"proteintech-18282-1-ap","title":"Proteintech, 18282-1-AP, CCDC85B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC85B (18282-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC85B in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n18282-1-AP targets CCDC85B in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue,  mouse lung tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCoiled-coil domain-containing protein 85B (CCDC85B), also named as DIPA, is 202 amino acid protein, which belongs to the CCDC85 family. CCDC85B localizes in the nucleus and cytoplasm. CCDC85B is widely expressed in many tissues and functions as a transcriptional repressor. CCDC85B may inhibit the activity of CTNNB1 in a TP53-dependent manner and thus regulate cell growth. CCDC85B may play a role in adipocyte differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13129 Product name: Recombinant human CCDC85B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-202 aa of BC008796 Sequence: MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD Predict reactive species\nFull Name: coiled-coil domain containing 85B\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 24-28 kDa\nGenBank Accession Number: BC008796\nGene Symbol: CCDC85B\nGene ID (NCBI): 11007\nRRID: AB_2878527\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15834\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869521858729,"sku":"18282-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18282-1-ap","provider":"Iright","version":"1.0","type":"link"}