{"product_id":"proteintech-18318-1-ap","title":"Proteintech, 18318-1-AP, NHE8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NHE8 (18318-1-AP) by Proteintech is a Polyclonal antibody targeting NHE8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n18318-1-AP targets NHE8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse testis tissue,  mouse colon tissue,  mouse liver tissue,  mouse kidney tissue\nPositive IHC detected in: human kidney tissue, human colon tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human skin tissue,  human testis tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNHE8, encoded by SLC9A8, is a member of sodium\/hydrogen exchanger family which are transmembrane proteins that mediate the electroneutral exchange of sodium (Na) for hydrogen (H) and get involved in intracellular pH homeostasis, cell volume regulation, acid-base regulation, and so on. NHE8 has a broad tissue distribution, with relatively high abundance in the gastrointestinal tract. It has been reported that NHE8 expression differs among different regions in the stomach, very low in nonglandular region whereas very high in glandular region. The predicted molecular weight of NHE8 is 64-65 kDa, while its glycosylated form often migrates around 70-85 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13111 Product name: Recombinant human NHE8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 471-581 aa of BC112213 Sequence: IRLMDIEDAKAHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL Predict reactive species\nFull Name: solute carrier family 9 (sodium\/hydrogen exchanger), member 8\nCalculated Molecular Weight: 581 aa, 65 kDa\nObserved Molecular Weight: 70-85 kDa\nGenBank Accession Number: BC112213\nGene Symbol: SLC9A8\nGene ID (NCBI): 23315\nRRID: AB_2270442\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2E8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869718925481,"sku":"18318-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18318-1-ap","provider":"Iright","version":"1.0","type":"link"}