{"product_id":"proteintech-18336-1-ap","title":"Proteintech, 18336-1-AP, LSM14A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LSM14A (18336-1-AP) by Proteintech is a Polyclonal antibody targeting LSM14A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n18336-1-AP targets LSM14A in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  PC-3 cells,  HEK-293T cells,  HepG2 cells,  Jurkat cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLSm14A was originally discovered to be a component of the P-bodies, it is a member of the LSm family of proteins, which have been shown to be involved in RNA processing events. The N terminus of LSm14A is a conserved LSm domain, whereas the C terminus contains two domains called \"DFDF box\" and \"FDF_TFG box\", respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12997 Product name: Recombinant human LSM14A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-463 aa of BC016842 Sequence: SSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA Predict reactive species\nFull Name: LSM14A, SCD6 homolog A (S. cerevisiae)\nCalculated Molecular Weight: 463 aa, 51 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC016842\nGene Symbol: LSM14A\nGene ID (NCBI): 26065\nRRID: AB_10644339\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8ND56\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893925545,"sku":"18336-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18336-1-ap","provider":"Iright","version":"1.0","type":"link"}