{"product_id":"proteintech-18340-1-ap","title":"Proteintech, 18340-1-AP, S100G\/Calbindin-D9k Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100G\/Calbindin-D9k (18340-1-AP) by Proteintech is a Polyclonal antibody targeting S100G\/Calbindin-D9k in IHC, ELISA applications with reactivity to human, mouse samples\n18340-1-AP targets S100G\/Calbindin-D9k in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100G also named calbindin D9K, is a vitamin D-dependent calcium-binding protein. This cytosolic protein belongs to a family of calcium-binding proteins that includes calmodulin, parvalbumin, troponin C, and S100 protein. In the intestine, the protein is vitamin D-dependent and its expression correlates with calcium transport activity. The protein may increase Ca2+ absorption by buffering Ca2+ in the cytoplasm and increase ATP-dependent Ca2+ transport in duodenal basolateral membrane vesicles.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13109 Product name: Recombinant human S100G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC112174 Sequence: MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ Predict reactive species\nFull Name: S100 calcium binding protein G\nCalculated Molecular Weight: 79 aa, 9 kDa\nGenBank Accession Number: BC112174\nGene Symbol: S100G\nGene ID (NCBI): 795\nRRID: AB_3085561\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P29377\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887791591593,"sku":"18340-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18340-1-ap","provider":"Iright","version":"1.0","type":"link"}