{"product_id":"proteintech-18370-1-ap","title":"Proteintech, 18370-1-AP, HCRTR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HCRTR1 (18370-1-AP) by Proteintech is a Polyclonal antibody targeting HCRTR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18370-1-AP targets HCRTR1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, SH-SY5Y cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe hypocretin receptor 1 (OX1R, also named HCRTR1) is a G protein-coupled receptor and is a critical participant in the regulation of motivated behavior (PMID:28971565). HCRTR1 is associated with the regulation of motivation, reward, and autonomic functions. HCRTR1 shows a selective binding affinity for HCRT1\/orexin-A. Moreover, HCRTR1 and HCRTR2 share 64% sequence similarity in humans (PMID:34052813).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12269 Product name: Recombinant human HCRTR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 321-425 aa of BC074796 Sequence: KRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP Predict reactive species\nFull Name: hypocretin (orexin) receptor 1\nCalculated Molecular Weight: 425 aa, 48 kDa\nObserved Molecular Weight: 48-54 kDa\nGenBank Accession Number: BC074796\nGene Symbol: HCRTR1\nGene ID (NCBI): 3061\nRRID: AB_10858633\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43613\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924956841,"sku":"18370-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18370-1-ap","provider":"Iright","version":"1.0","type":"link"}