{"product_id":"proteintech-18396-1-ap","title":"Proteintech, 18396-1-AP, PSAP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSAP (18396-1-AP) by Proteintech is a Polyclonal antibody targeting PSAP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n18396-1-AP targets PSAP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe PSAP gene encodes prosaposin, a precursor of fourl small nonenzymatic glycoproteins termed 'sphingolipid activator proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa  heatstable glycoproteins. This antibody should recognize saposin A.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13263 Product name: Recombinant human PSAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-143 aa of BC001503 Sequence: LPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQK Predict reactive species\nFull Name: prosaposin\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC001503\nGene Symbol: PSAP\nGene ID (NCBI): 5660\nRRID: AB_2172460\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07602\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868936163497,"sku":"18396-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18396-1-ap","provider":"Iright","version":"1.0","type":"link"}