{"product_id":"proteintech-18466-1-ap","title":"Proteintech, 18466-1-AP, PPIF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPIF (18466-1-AP) by Proteintech is a Polyclonal antibody targeting PPIF in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18466-1-AP targets PPIF in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  human heart tissue,  rat heart tissue,  mouse heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPIF, also named as Cyclophilin D (CypD), CYP3, PPIase F and Rotamase F, belongs to the cyclophilin-type PPIase family. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIF is a mitochondrial matrix protein involved in the induction of necrotic and apoptotic cell death through the activation of the mitochondrial permeability transition (mPT) pore. This antibody is immunized with full length gene PPIF and absorbed by PPIA. So this antibody is specific to PPIF.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13151 Product name: Recombinant human PPIF-Specific protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-207 aa of BC005020 Sequence: MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS Predict reactive species\nFull Name: peptidylprolyl isomerase F\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 16~22 kDa\nGenBank Accession Number: BC005020\nGene Symbol: PPIF\nGene ID (NCBI): 10105\nRRID: AB_2169273\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30405\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920369321,"sku":"18466-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18466-1-ap","provider":"Iright","version":"1.0","type":"link"}