{"product_id":"proteintech-18902-1-ap","title":"Proteintech, 18902-1-AP, SOX13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOX13 (18902-1-AP) by Proteintech is a Polyclonal antibody targeting SOX13 in WB, IP, ELISA applications with reactivity to human samples\n18902-1-AP targets SOX13 in WB, IHC, IF, IP, chIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BGC-823 cells, NCI-H1299 cells\nPositive IP detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSRY-BOX 13(SOX13), identified a sequence homologous more than 60% to the SRY HMG box ,with a centrally located HMG box and an N-terminal leucine zipper motif with a neighboring glutamine stretch called a Q box. SOX13 binds to the consensus HMG-box motif. It's an IDDM-specific human autoantigen, and a gamma-delta-specific gene in the immune system. It can modulates Wnt\/TCF activity. This is a rabbit polyclonal raised against part of N-terminal chain of SOX13 of human origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13537 Product name: Recombinant human SOX13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC106038 Sequence: MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDVKGTQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAMATHHPLQEPSQPLNLTAKPKA Predict reactive species\nFull Name: SRY (sex determining region Y)-box 13\nCalculated Molecular Weight: 622 aa, 69 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC106038\nGene Symbol: SOX13\nGene ID (NCBI): 9580\nRRID: AB_10642149\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UN79\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989608105,"sku":"18902-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18902-1-ap","provider":"Iright","version":"1.0","type":"link"}