{"product_id":"proteintech-18941-1-ap","title":"Proteintech, 18941-1-AP, LSM7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LSM7 (18941-1-AP) by Proteintech is a Polyclonal antibody targeting LSM7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n18941-1-AP targets LSM7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13498 Product name: Recombinant human LSM7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-103 aa of BC018621 Sequence: MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA Predict reactive species\nFull Name: LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae)\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC018621\nGene Symbol: LSM7\nGene ID (NCBI): 51690\nRRID: AB_10596483\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UK45\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869705064617,"sku":"18941-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-18941-1-ap","provider":"Iright","version":"1.0","type":"link"}