{"product_id":"proteintech-19425-1-ap","title":"Proteintech, 19425-1-AP, COX16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX16 (19425-1-AP) by Proteintech is a Polyclonal antibody targeting COX16 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n19425-1-AP targets COX16 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  SH-SY5Y cells\nPositive IHC detected in: human stomach tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13756 Product name: Recombinant human COX16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC001702 Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT Predict reactive species\nFull Name: COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)\nCalculated Molecular Weight: 106 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC001702\nGene Symbol: COX16\nGene ID (NCBI): 51241\nRRID: AB_10666854\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P0S2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964343977,"sku":"19425-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19425-1-ap","provider":"Iright","version":"1.0","type":"link"}