{"product_id":"proteintech-19429-1-ap","title":"Proteintech, 19429-1-AP, ZIP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZIP7 (19429-1-AP) by Proteintech is a Polyclonal antibody targeting ZIP7 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n19429-1-AP targets ZIP7 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human kidney tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZIP7 is a functional zinc transporter transporting zinc from the Golgi apparatus to the cytoplasm of the cell. ZIP7 is post-translationally regulated by CK2-mediated phosphorylation. This ZIP7 phosphorylation results in zinc release from intracellular stores, which activates multiple tyrosine kinases and regulate cell survival and proliferation. Dual bands of 50 kDa and 56 kDa detected by this antibody may represent the native and phosphorylated forms of ZIP7, respectively. (PMID: 28232492, 28205653)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13762 Product name: Recombinant human SLC39A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 237-384 aa of BC000645 Sequence: VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 7\nCalculated Molecular Weight: 469 aa, 50 kDa\nObserved Molecular Weight: 45-50 kDa, 56 kDa\nGenBank Accession Number: BC000645\nGene Symbol: ZIP7\nGene ID (NCBI): 7922\nRRID: AB_10643376\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92504\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868872921257,"sku":"19429-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19429-1-ap","provider":"Iright","version":"1.0","type":"link"}