{"product_id":"proteintech-19446-1-ap","title":"Proteintech, 19446-1-AP, ALDH3B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALDH3B1 (19446-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH3B1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n19446-1-AP targets ALDH3B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, J774A.1 cells,  rat liver tissue\nPositive IHC detected in: human lung cancer tissue,  human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALDH3B1(Aldehyde dehydrogenase family 3 member B1) is also named as ALDH7 and belongs to the aldehyde dehydrogenase family. It catalyzes fatty and aromatic aldehydes. ALDH3B1 may play a role in the detoxification of aldehydes produced during oxidative stress. This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7025 Product name: Recombinant human ALDH3B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-230 aa of BC002553 Sequence: MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHPSKQRLPPPSWVFPLPASASSLSRSQP Predict reactive species\nFull Name: aldehyde dehydrogenase 3 family, member B1\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC002553\nGene Symbol: ALDH3B1\nGene ID (NCBI): 221\nRRID: AB_2861362\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43353\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869392425129,"sku":"19446-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19446-1-ap","provider":"Iright","version":"1.0","type":"link"}