{"product_id":"proteintech-19826-1-ap","title":"Proteintech, 19826-1-AP, TM7SF3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TM7SF3 (19826-1-AP) by Proteintech is a Polyclonal antibody targeting TM7SF3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n19826-1-AP targets TM7SF3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HepG2 cells,  mouse pancreas tissue,  mouse testis tissue,  U2OS cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe seven-transmembrane superfamily member 3 protein (TM7SF3) is a pro-survival factor induced by p53 that regulates protein homeostasis and attenuates cellular stress. TM7SF3 inhibits caspase 3\/7 while siRNA-mediated silencing of TM7SF3 accelerates ER stress and the unfolded protein responses (UPR). This involves inhibitory phosphorylation of eIF2α activity and increased expression of ATF3, ATF4, and C\/EBP, followed by induction of apoptosis. TM7SF3 maintains cellular reducing power within physiological levels and reduces the content of proapoptotic proteins such as FAS, FADD, and caspase-8. (PMID: 36304109)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13919 Product name: Recombinant human TM7SF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC005176 Sequence: MGFLQLLVVAVLASEHRVAGAAEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISSNVTFLIFQIHSQYQNTTVSFSPTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPVQNMAILLSYSERDPVPGGCNLEFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFLPENDLTEEMLLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWDPFLNTSAAYIPAHTYACSFEAGEGSCASLGRVSSK Predict reactive species\nFull Name: transmembrane 7 superfamily member 3\nCalculated Molecular Weight: 570 aa, 64 kDa\nObserved Molecular Weight: 64-80 kDa\nGenBank Accession Number: BC005176\nGene Symbol: TM7SF3\nGene ID (NCBI): 51768\nRRID: AB_10638000\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NS93\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887829242025,"sku":"19826-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19826-1-ap","provider":"Iright","version":"1.0","type":"link"}