{"product_id":"proteintech-19832-1-ap","title":"Proteintech, 19832-1-AP, FUNDC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FUNDC2 (19832-1-AP) by Proteintech is a Polyclonal antibody targeting FUNDC2 in WB, IHC, ELISA applications with reactivity to human samples\n19832-1-AP targets FUNDC2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HuH-7 cells,  HepG2 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFUNDC2, or FUN14 domain-containing protein 2, is a mitochondrial outer membrane protein that plays a significant role in various cellular processes, including the regulation of cell survival, apoptosis, and metabolism. It has been implicated in the progression of several types of cancer, particularly in triple-negative breast cancer (TNBC) and liver cancer. In the context of cancer, FUNDC2 has been shown to promote tumorigenesis. It is associated with poor prognosis in hepatocellular carcinoma (HCC) and is involved in mitochondrial fragmentation by inhibiting MFN1-mediated mitochondrial fusion, which can lead to changes in cellular metabolism and energy levels. FUNDC2 also plays a role in platelet function and survival. It binds directly to phosphatidylinositol-3,4,5-trisphosphate (PIP3), which is a key lipid second messenger in cell signaling, and this interaction is crucial for the recruitment of PIP3 to mitochondria. FUNDC2 deficiency has been shown to decrease platelet aggregation and impair hemostasis in mice, highlighting its importance in platelet function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13800 Product name: Recombinant human FUNDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC000255 Sequence: METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLF Predict reactive species\nFull Name: FUN14 domain containing 2\nCalculated Molecular Weight: 189 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC000255\nGene Symbol: FUNDC2\nGene ID (NCBI): 65991\nRRID: AB_3085587\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BWH2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644430505,"sku":"19832-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19832-1-ap","provider":"Iright","version":"1.0","type":"link"}