{"product_id":"proteintech-19848-1-ap","title":"Proteintech, 19848-1-AP, C14orf166 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C14orf166 (19848-1-AP) by Proteintech is a Polyclonal antibody targeting C14orf166 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n19848-1-AP targets C14orf166 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse pancreas tissue,  mouse lung tissue,  Jurkat cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman CLE\/C14orf166 protein is a positive modulator of cellular RNA polymerase. CLE is also shown to interact with the influenza virus polymerase complex and colocalizes with viral ribonucleoproteins, and is required for viral replication. Similarly, CLE is identified as a novel host interacting partners of the mature hepatitis C virus core protein. CLE levels were significantly higher in the serum of patients with PaCa compared with the control group was strongly expressed in tumor cells, suggesting that C14orf166 may be a potential biomarker of pancreatic adenocarcinoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13900 Product name: Recombinant human CLE; C14orf166 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC001722 Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR Predict reactive species\nFull Name: chromosome 14 open reading frame 166\nCalculated Molecular Weight: 244 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC001722\nGene Symbol: C14orf166\nGene ID (NCBI): 51637\nRRID: AB_10646485\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y224\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939079849,"sku":"19848-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19848-1-ap","provider":"Iright","version":"1.0","type":"link"}