{"product_id":"proteintech-19850-1-ap","title":"Proteintech, 19850-1-AP, Thymosin beta 4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Thymosin beta 4 (19850-1-AP) by Proteintech is a Polyclonal antibody targeting Thymosin beta 4 in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n19850-1-AP targets Thymosin beta 4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThymosin beta 4 (Tβ4), encoded by TMSB4X gene, is an actin sequestering protein which plays an important role in the organization of the cytoskeleton. Numerous studies have demonstrated the effects of Tβ4 on cell migration, proliferation, apoptosis and inflammation after exogenous treatment (PMID: 22652458). Recently, novel findings provided compelling evidence that Tβ4 played a key role in facilitating tumor metastasis and angiogenesis. It has been found that Tβ4 expressed increasingly in a number of metastatic tumors, thus providing a potential target of opportunity for cancer management, especially for cancer metastasis therapy (PMID: 22856429).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13914 Product name: Recombinant human TMSB4X protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC001631 Sequence: AQTRLRSYSCASLRFSSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES Predict reactive species\nFull Name: thymosin beta 4, X-linked\nCalculated Molecular Weight: 63 aa, 7 kDa\nObserved Molecular Weight: 5 kDa\nGenBank Accession Number: BC001631\nGene Symbol: Thymosin beta 4\nGene ID (NCBI): 7114\nRRID: AB_10642437\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62328\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868883210409,"sku":"19850-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-19850-1-ap","provider":"Iright","version":"1.0","type":"link"}